Protein Info for Shewana3_2015 in Shewanella sp. ANA-3

Annotation: putative PAS/PAC sensor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1119 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details PF00672: HAMP" amino acids 170 to 220 (51 residues), 45.6 bits, see alignment 3.5e-15 TIGR00229: PAS domain S-box protein" amino acids 233 to 352 (120 residues), 82.4 bits, see alignment E=1.5e-27 amino acids 358 to 484 (127 residues), 81.2 bits, see alignment E=3.4e-27 PF00989: PAS" amino acids 233 to 344 (112 residues), 47.6 bits, see alignment E=8.1e-16 amino acids 366 to 474 (109 residues), 52 bits, see alignment E=3.4e-17 PF13426: PAS_9" amino acids 243 to 347 (105 residues), 49.5 bits, see alignment E=2.2e-16 amino acids 371 to 476 (106 residues), 52 bits, see alignment E=3.8e-17 PF08448: PAS_4" amino acids 367 to 478 (112 residues), 33.4 bits, see alignment E=2.3e-11 PF00512: HisKA" amino acids 498 to 562 (65 residues), 64.6 bits, see alignment 3.5e-21 PF02518: HATPase_c" amino acids 609 to 723 (115 residues), 102.5 bits, see alignment E=9.2e-33 PF00072: Response_reg" amino acids 877 to 987 (111 residues), 91.6 bits, see alignment E=1.9e-29 PF01627: Hpt" amino acids 1031 to 1102 (72 residues), 50.2 bits, see alignment 1.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_2015)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWS7 at UniProt or InterPro

Protein Sequence (1119 amino acids)

>Shewana3_2015 putative PAS/PAC sensor protein (RefSeq) (Shewanella sp. ANA-3)
MSFRLKTILGIALIEGLLLFLLVYTSINYLKLSNQSQIEKRAETTLTLFSVAAQDAVISN
DLATLHSLIQELLSHSEVLYVTVSDQSRILAYGGADKYIQVSHQADKHLDQVKDGIFDLE
YPIEVNGYLFGKVNMGFETQSLENLVNTVTQQILSIAGVEMLLVALFSLLLGHYLTRNLT
QLTSASKRILAGEIGVRVPVKGKDEIAQMTRAFNNMVDKVDARTKALEAANIRLNTILES
AVDGFVIINEFGIITDINPAVSRLFGYAHNELIGQNVSIFMPFDQRPLHDGYIQQYFTTH
VAKIIGTSRELTAQRKDGQLFPIALSVSQMSIDNRAMFIGLVKDLSEAKRKEIAAAKTES
VLLATLAASQDCLITIDMSGKVIEFNLAATRLFGYSREEAVGALLEDLIIPEDKQQGHKR
GIERYRRTGEGKMLNKRVELLARCKAGNLIPIELEVVPIQLGDEVLFTAFLRDISERKAN
EQKLQQAKEQAEQGSKVKSRFLATMSHEIRSPLNAILGGVELLLDSSLSKDQRIHANIAR
EAGSALLHTINDILDFSKIEAGQMVLESHEFEPDKLVAQVLQILEPKAFEKGLELVSFVN
RNVPRTVVGDQQRLRQVLHNLVDNAIKFTASGTITVEMWIPDNHQTEVQLYCRVTDSGIG
ISAEAQSKLFKEFSQVHDTHNTNYKGTGLGLAICSELITMMGGTIELQSELGQGSRFTFY
VSLQLLEGNFCHSHYFPAHSRVLLAHHDATWLSLVSKQYSQYGVETVEVMDWPSIKRAKK
IKGQFNLILLDEGFFLDVNEQDVNRLRQAHLTADGSMVALVSGMSTEITHSLATLGLDQV
VNKPLSRAMQLALLSKDALANEFEEEYVAQEKFQGHILLAEDSPANQIIAGTMLTKAGFD
ITYACNGLEAVKLVAEKPFDLVLMDVRMPEMDGLEATEVILQNHPEQVILAMSANVMKEE
IEHCYRVGMKDFIAKPVKQKTLLHAIQKWLPNAVVSLPSSHKPAENTASLLDEQLLAELE
QTLGKASLSNMMTIFCDELAQRLNQLSELDSTQVDEIEDQAHTLKSSSGSFGATALFLLA
QKLEACARQQQLGAIPELMAQINVLGKQTHSLLTERFIQ