Protein Info for Shewana3_1925 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details amino acids 468 to 495 (28 residues), see Phobius details amino acids 501 to 521 (21 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 484 (447 residues), 87.2 bits, see alignment E=1.1e-28 PF13347: MFS_2" amino acids 76 to 277 (202 residues), 36.7 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1925)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWI7 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Shewana3_1925 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MSADQQTVTPLENFSPKVAQRAVHRVQPELNFWQIFNMCFGFLGIQFGFALQNANVSRIF
QTLGASIDDIPILWIAAPLTGLLVQPIIGYLSDNTWGRLGRRRPYFLIGAICTTLAIFVM
PHSPTLWIAAGMLWIMDASINIAMEPFRAFVGDNLPPKQRTQGYAMQSFFIGIGAVVASA
LPYVLSNYFDVANTAPAGEIADSVRYAFYFGGAVLFLSVAWTVVSTKEYSPDELAAFHGN
ADAGADEQQHRTRTHKNYQFAAIVWMAVGALLTFAVWAQDLDKQLYILTLGIFVFGPLQL
YCALRLGKSTPSQRAQLGIVFNVVDDLFHMPKAMHQLAIVQFFSWFALFAMWIYTTSAVT
SYHFGSSDVLSKAYNDGADWVGVLFASYNGFSAIAALFIPLLAKRIGIKLTHTFNMFCGG
FGLISFYFIKDPSLLWLPMIGVGIAWASILSVPYAMLSGALPPKKMGVYMGIFNFFIVIP
QLLAASVLGLILNGLFDGQPIYALITGGVLMLCAGIAVLFVEQPNTQHTQA