Protein Info for Shewana3_1833 in Shewanella sp. ANA-3

Annotation: putative prophage repressor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00717: Peptidase_S24" amino acids 33 to 138 (106 residues), 43.4 bits, see alignment E=1.3e-15 amino acids 162 to 255 (94 residues), 56 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 100% identity to shn:Shewana3_1833)

Predicted SEED Role

"Error-prone repair protein UmuD"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW97 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Shewana3_1833 putative prophage repressor (RefSeq) (Shewanella sp. ANA-3)
MLATITVFTYSNYIAMRVYPIIPWPAHAGISGFESPAAEYTQLGLCLDDLLVLHPSATRL
CIAQGDSMKGVGIFDGDLLIIDRHIKPHTGCVIYGQLNGEFICKIYDEKQRMLLSSHENC
QAIVIHDYDDFCVEGVVIRTLRQHFYLNDSINIASDYSELRTNLDDLLVLHPCATWFGVA
QGDSMQDEGIYDRDILIIDRQVNALQGAVIVAQLNGEFICKIFDKKRRMLLSANPQYHAV
PIRDCDTFSVEGIVIRSVRMHFKSSLQGLWSCTP