Protein Info for Shewana3_1773 in Shewanella sp. ANA-3

Annotation: paraquat-inducible protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF04403: PqiA" amino acids 42 to 198 (157 residues), 163 bits, see alignment E=2.6e-52

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 100% identity to shn:Shewana3_1773)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW37 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Shewana3_1773 paraquat-inducible protein A (RefSeq) (Shewanella sp. ANA-3)
MKQQGKDLDLCLCRVCRQLNSSDNTHCSRCEAELQVRDYSSLQKSWALLITAAILLVPAN
LYPITMLTNQGQVRHDTIFSGIIHLVHSDMLPIAIIVFIASILVPWVKIIGLATYLCAIS
FNLPISKKKLMVGFHVIEWIGRWSMLDLFVISLTVALVNMGQLLDAKPAPAATAFALVIL
LTQLAAKVLDTRLLWDRLEPQDDTN