Protein Info for Shewana3_1771 in Shewanella sp. ANA-3

Annotation: nucleoside recognition domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details PF07670: Gate" amino acids 48 to 157 (110 residues), 44.1 bits, see alignment E=1.2e-15 amino acids 275 to 378 (104 residues), 50.5 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_1666)

Predicted SEED Role

"Fused spore maturation proteins A and B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW35 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Shewana3_1771 nucleoside recognition domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MLNRVWLVFFLTSLLAMAVQLFNGHIEVLANAVEALFASAKLAAEIALGLVGVLSLWMGL
MRIGEKAGVVGAIAFVFEPLLRRVMPEVPKGHPAFGSMTMNLTANVFGLDNAATPLGLKA
MQDLQSLNPVKTVATNAQILFLVLNTSSVTLVPVTVFLYRAQQGAAAPADIFLPIILATS
ASTLAGLLIVAVVQRLSLLNAVVLGYGAVLLSALVASGFYLMTLTADAIGTVSTALGNGV
LLLLVFSFVLVAGMRKVAIYDEFIEGAKAGFNQSIQLIPYLLAMLLAIGLLRASGALDYL
LQLIASGVSLFGFDTRFVDAMPTALMKPFSGSGARAMMLETMAHHGVDSFAGRLAAIFQG
STETTFYVLAVYFGSVGIRHGRHALACGLTADFAGICAAIAVCYWFYG