Protein Info for Shewana3_1742 in Shewanella sp. ANA-3

Annotation: leucine dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF02812: ELFV_dehydrog_N" amino acids 12 to 130 (119 residues), 104 bits, see alignment E=5.1e-34 PF00208: ELFV_dehydrog" amino acids 146 to 197 (52 residues), 24.5 bits, see alignment 2e-09 amino acids 217 to 328 (112 residues), 39.1 bits, see alignment E=7.4e-14

Best Hits

Swiss-Prot: 59% identical to DHLE_BACSU: Leucine dehydrogenase (yqiT) from Bacillus subtilis (strain 168)

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 100% identity to she:Shewmr4_1598)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW06 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Shewana3_1742 leucine dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MAVFNHVSFDEHEQVVFCHDKESGLKAIVAIHNTNLGPAVGGCRMWNYQSDDEALTDVLR
LSRGMTYKNALAGLTMGGGKSVIIADPKRPDREALFRAFGRFINSLGGRYYSAEDVGTTT
ADIMIAHQETPYMAGLEGKSGDPSPFTALGTYLGIKAAVKHKLGLDSLKGLKIAVQGVGH
VGYYLCKHLHEEGAELIVTDIHQASLDKVATDFGAIVVAPQDIYAQDVDVYAPCALGATL
NDVTLPQLKAKIVAGCANNQLAEVRHGEQLKEMGILYAPDYVINAGGIINVSFEKDYDAA
KSEAKVREIYNTLLKIFTKADAENRTTAAVADEMARAIYQAAKA