Protein Info for Shewana3_1711 in Shewanella sp. ANA-3

Annotation: 2-oxoglutarate dehydrogenase E2 component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 3 to 396 (394 residues), 599.3 bits, E=2.2e-184
• PF00364: Biotin_lipoyl
  • amino acids 4 to 75 (72 residues), 57.4 bits, E=1.5e-19
• PF02817: E3_binding
  • amino acids 109 to 142 (34 residues), 54.6 bits, 1.5e-18
• PF00198: 2-oxoacid_dh
  • amino acids 167 to 395 (229 residues), 282.3 bits, E=4.1e-88

Best Hits

Swiss-Prot: 73% identical to ODO2_ECOLI: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Escherichia coli (strain K12)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to shn:Shewana3_1711)

MetaCyc: 73% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (5/23 steps found)
• superpathway of L-lysine degradation (7/43 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.105 or 2.3.1.61

Sequence Analysis Tools

See A0KVX5 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Shewana3_1711 2-oxoglutarate dehydrogenase E2 component (RefSeq) (Shewanella sp. ANA-3)
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVSGQEVTKAEAEAAAPVAAAATEESNDALSPSVRRLLAEH
NVDASKVKGTGVGGRITKEDVEAFIKSAPKAAAPAAPAVQPLAAGRSEKRVPMTRLRKTI
ANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEALKR
FPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGRD
GKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMM
YLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL