Protein Info for Shewana3_1692 in Shewanella sp. ANA-3

Annotation: Xaa-His dipeptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 319 to 336 (18 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details PF07690: MFS_1" amino acids 42 to 273 (232 residues), 100.4 bits, see alignment E=5e-33 amino acids 260 to 419 (160 residues), 44.1 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1692)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVV6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shewana3_1692 Xaa-His dipeptidase (RefSeq) (Shewanella sp. ANA-3)
MLCPVLIFVYPECDALSRPKVQAVLDTIIDSKQRDTRLMWALCVASVVVYINLYLMQGML
PLIAEHFAVSGSKATLILSVTSFSLAFSLLIYAVVSDRIGRHTPIVVSLWLLALSNLLLI
WAGDFNALVYVRFLQGVLLAAVPAIAMAYFKEQLSPSTMLKAAGIYIMANSIGGIVGRLL
GGVMSQFLSWQESMWLLFLVTLAGVALTSYLLPSGADAQAVSGGQTTSPTLSKRARLLQD
IYGFSHHLTDPQMRLAYAIGGITFMMMVNQFSFIQLHLMAAPYEWSRFQATLIFLCYSSG
TVASYFTAKWLAKFGQHKLYQWSWCLMLLGSLLTLFDTPVTISLGFLMTACGFFLTHSCC
NSFVAMRASRDRAKATSLYLCCYYLGAALGGPYLMLFWHKAEWQGVVMGSLTLLALIALA
IGRLRYHQTQMSRVTL