Protein Info for Shewana3_1653 in Shewanella sp. ANA-3

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 111 to 127 (17 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF01810: LysE" amino acids 14 to 198 (185 residues), 123.8 bits, see alignment E=3.1e-40

Best Hits

Swiss-Prot: 41% identical to ARGO_KLEP3: Arginine exporter protein ArgO (argO) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 97% identity to son:SO_2865)

MetaCyc: 39% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVR7 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Shewana3_1653 lysine exporter protein LysE/YggA (RefSeq) (Shewanella sp. ANA-3)
MQTAFIQGMGIGGSLIIAVGAQNAFVLKQGIKRAYPLPIALLCSIIDALMITAGVAGLGH
IIEAFPTIKHVASFGGAAFLIWYGANALKASFVAKGMEMGNAQNADTLRKAMLTTLGISL
LNPHLYLDTVVLLGSISTQFEDAHRPWFGAGAVLASFIWFFSLSFGARLLAPIFSRPAAW
RYLDRFIWLTMWSIAAAVIWPYLA