Protein Info for Shewana3_1626 in Shewanella sp. ANA-3

Annotation: pyridoxamine 5'-phosphate oxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 3 to 212 (210 residues), 287.1 bits, E=4.2e-90
• PF01243: Putative_PNPOx
  • amino acids 33 to 118 (86 residues), 82.9 bits, E=1.5e-27
• PF10590: PNP_phzG_C
  • amino acids 172 to 212 (41 residues), 75 bits, 3.5e-25

Best Hits

Swiss-Prot: 100% identical to PDXH_SHESA: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 99% identity to shm:Shewmr7_1634)

MetaCyc: 68% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (2/9 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

See A0KVP0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Shewana3_1626 pyridoxamine 5'-phosphate oxidase (RefSeq) (Shewanella sp. ANA-3)
MTDLSDIRREYTKGGLRRADLPQNPMQLFELWMTQARDAELSDPTAMCVATVDEHGQPYQ
RIVLLKRFDDTGFVFFTNLGSRKAQQIATNNKVSLHFPWHPIERQVSILGEAQPLSTAEV
LKYFMTRPKDSQIAAWVSQQSSKLSARQVLEGKFFEMKAKFAKGDVPLPSFWGGYLVKPS
SIEFWQGGEHRLHDRFLYTRQADEWVIDRLAP