Protein Info for Shewana3_1624 in Shewanella sp. ANA-3

Annotation: arginine decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01273: arginine decarboxylase
  • amino acids 4 to 634 (631 residues), 881.7 bits, E=1.4e-269
• PF02784: Orn_Arg_deC_N
  • amino acids 80 to 346 (267 residues), 158 bits, E=4.2e-50
• PF17810: Arg_decarb_HB
  • amino acids 371 to 457 (87 residues), 97.1 bits, E=9e-32
• PF17944: Arg_decarbox_C
  • amino acids 585 to 633 (49 residues), 51.8 bits, 1.4e-17

Best Hits

Swiss-Prot: 100% identical to SPEA_SHESA: Biosynthetic arginine decarboxylase (speA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01585, arginine decarboxylase [EC: 4.1.1.19] (inferred from 100% identity to shn:Shewana3_1624)

MetaCyc: 57% identical to biosynthetic arginine decarboxylase (Escherichia coli K-12 substr. MG1655)
Arginine decarboxylase. [EC: 4.1.1.19]

Predicted SEED Role

"Biosynthetic arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.19)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• arginine dependent acid resistance (1/1 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (1/2 steps found)
• putrescine biosynthesis I (1/2 steps found)
• spermidine biosynthesis III (2/4 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Sequence Analysis Tools

See A0KVN8 at UniProt or InterPro

Protein Sequence (637 amino acids)

>Shewana3_1624 arginine decarboxylase (RefSeq) (Shewanella sp. ANA-3)
MNDWSIDAARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPDHKIGLNELAKDMVKAGVAL
PVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQKTVVEEILASQASKE
VPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLS
ELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQED
MLDSLQLLHFHLGSQIANIRDIRQGVSEAARFYCELRELGASINCFDVGGGLAVDYDGTR
SQSNNSMNYGLSEYANNIVNVLTDICNEYEQPMPRIISESGRHLTAHHAVLITDVIGTEA
YQVEEIQPPAEESPQLLHNMWQSWTEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLS
LAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGI
DQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLMG
FFMVGAYQEILGDMHNLFGDTNSAVVSIEENGMTNIESVLAGDTVADVLRYVNLDAVDFM
RTYEELVNQHIAEEERAQILEELQVGLKGYTYLEDFS