Protein Info for Shewana3_1589 in Shewanella sp. ANA-3

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00583: Acetyltransf_1" amino acids 44 to 136 (93 residues), 52.9 bits, see alignment E=9e-18 PF13508: Acetyltransf_7" amino acids 52 to 137 (86 residues), 41.3 bits, see alignment E=3.3e-14 PF13673: Acetyltransf_10" amino acids 81 to 139 (59 residues), 27.6 bits, see alignment E=5e-10 PF08445: FR47" amino acids 82 to 139 (58 residues), 22.6 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 43% identical to YHFO_BACSU: Uncharacterized N-acetyltransferase YhfO (yhfO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_1595)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVK4 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Shewana3_1589 GCN5-related N-acetyltransferase (RefSeq) (Shewanella sp. ANA-3)
MANIISRADVSHSHEVALLFNEYRQFYGCKDDVLAAEQFIRARLQDASSVVFMARSPEGM
GLGFVQLYPSFSSLRLAPIFILNDVFVTQHARCVGIGRALVQQAAEYAKAQGARALVLET
QKENVRAQGLYEALGFVRDQKFLTYELEIHSLLK