Protein Info for Shewana3_1556 in Shewanella sp. ANA-3

Annotation: methionine gamma-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 81 to 108 (28 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details TIGR04060: formate transporter FocA" amino acids 27 to 291 (265 residues), 419.3 bits, see alignment E=5.6e-130 PF01226: Form_Nir_trans" amino acids 30 to 288 (259 residues), 248.5 bits, see alignment E=3.1e-78 TIGR00790: formate/nitrite transporter" amino acids 44 to 290 (247 residues), 247.4 bits, see alignment E=1.5e-77

Best Hits

KEGG orthology group: K06212, formate transporter (inferred from 100% identity to shn:Shewana3_1556)

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVH1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Shewana3_1556 methionine gamma-lyase (RefSeq) (Shewanella sp. ANA-3)
MKDSHANAPQTSSTGHEPIQVSSHFSCYHQAEIYGKSKVVKAPWQSFGLAVFAGAFIALA
FVFYLTVTTGAGDSAWGLVRLVGGIAFSLGLILVVICGGELFTSSVLSSVAWAQKQVTTS
ELLKCWSRVYIGNFVGAMLMVGLIMAAGLYELDGGNWGLNALKVSQHKLHHTWVQAFSLG
ILCNMLVCLGIWMTFASRESLTKAILLILPVAMFVSSGFEHSIANLFMVPLGITIQSVAS
PEFFASLGVTQEQFADLTVANFVFNNLIPVTLGNIVGGGVIVGLGYWWIEQGQIALPDPQ
KSHQPHFFASPLHTEKAKNSQESK