Protein Info for Shewana3_1527 in Shewanella sp. ANA-3

Annotation: transposase IS200-family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF01797: Y1_Tnp" amino acids 11 to 129 (119 residues), 136.4 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 43% identical to T200_SALTY: Transposase for insertion sequence element IS200 (tnpA1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_2843)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVE2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Shewana3_1527 transposase IS200-family protein (RefSeq) (Shewanella sp. ANA-3)
MGDYRSSSHVYWRCKYHIVWTPKYRFKILKGNLGKELYRSIYILCNMKSCEVLELNVQID
HVHLVVIIPPKLSVSTLMGILKGRSAIRLFNKFPHARKKLWGNSFWARGYFVDTVGVNEE
IIRRYVRHQDKQDLEHDAQLSLQMK