Protein Info for Shewana3_1503 in Shewanella sp. ANA-3

Annotation: exonuclease III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00195: exodeoxyribonuclease III" amino acids 1 to 267 (267 residues), 309.7 bits, see alignment E=1.8e-96 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 1 to 267 (267 residues), 276.4 bits, see alignment E=2.3e-86 PF03372: Exo_endo_phos" amino acids 4 to 260 (257 residues), 111.5 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 63% identical to EX3_ECOLI: Exodeoxyribonuclease III (xthA) from Escherichia coli (strain K12)

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 100% identity to shn:Shewana3_1503)

MetaCyc: 63% identical to exodeoxyribonuclease III (Escherichia coli K-12 substr. MG1655)
3.1.4.-; 3.1.3.-; Deoxyribonuclease IV (phage-T(4)-induced). [EC: 3.1.21.2]; Exodeoxyribonuclease III. [EC: 3.1.21.2, 3.1.11.2]

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.2 or 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVB8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Shewana3_1503 exonuclease III (RefSeq) (Shewanella sp. ANA-3)
MKIVSFNINGLRSRLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYHVHYHGGK
AHYGVAMLSKVAPLKVQKGFATDEEDAQRRMIIGTFAQANGHPLTVLNGYFPQGESIDHP
TKYPAKRKFYQDLMAHLHANHSNDEDIAIIGDINISPIDLDIGIGEVNRKRWLKTGKCSF
QPEEREWLKTLQGWGLVDTFRQLHPDRCERYSWFDYRSKGFDDNRGLRIDVILATPSLAA
RLVESDVDYELRGIDKPSDHAPIWSTFKEA