Protein Info for Shewana3_1447 in Shewanella sp. ANA-3

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 27 to 327 (301 residues), 174.3 bits, see alignment E=1.6e-55 PF25917: BSH_RND" amino acids 49 to 184 (136 residues), 35.7 bits, see alignment E=1.3e-12 PF25876: HH_MFP_RND" amino acids 88 to 158 (71 residues), 41.1 bits, see alignment E=3.4e-14 PF25954: Beta-barrel_RND_2" amino acids 199 to 266 (68 residues), 23.8 bits, see alignment E=8.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1447)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV62 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shewana3_1447 RND family efflux transporter MFP subunit (RefSeq) (Shewanella sp. ANA-3)
MAAISRTLFTLFVFSPFATQAAPLATLEVMSKPYANWVTLDASIEAVKAATVSAQTSGRI
VKLNYDVNDVVPEGAALLEITSKEQGAELASYEADLAKATALNVEAQAQYKRYKELFPQG
AISKGAMDEATANAKAAEQAVSAAKARVIKATESLKYTVVSAPFSGIVTERLVELGETVS
VGQPLLSGFSPSQMRAITQVPQRYIQQLKNAPEFMVRLSDGRELTSKDLTIFSFADPVSH
SYQVRINLPKDEPNLQPGTWAKALFKNGEREKIQLPTSTLITMNELSSVYLKKGEQFVLT
QVRVSEPVGGEVEVLAGLRTGDIVAMDAYQVLLEQKQ