Protein Info for Shewana3_1436 in Shewanella sp. ANA-3
Annotation: protein translocase subunit yajC (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to YAJC_ECO57: Sec translocon accessory complex subunit YajC (yajC) from Escherichia coli O157:H7
KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 90% identity to sse:Ssed_2891)MetaCyc: 63% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KV51 at UniProt or InterPro
Protein Sequence (91 amino acids)
>Shewana3_1436 protein translocase subunit yajC (RefSeq) (Shewanella sp. ANA-3) MELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLTKGDEVLTSGGILGKIAKISDEND YVLLSLNDTTQITIKKDYIAAVLPKGSIQSL