Protein Info for Shewana3_1436 in Shewanella sp. ANA-3

Annotation: protein translocase subunit yajC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details amino acids 22 to 23 (2 residues), see Phobius details transmembrane" amino acids 20 to 21 (2 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 1 to 83 (83 residues), 107.8 bits, see alignment E=1.1e-35 PF02699: YajC" amino acids 3 to 80 (78 residues), 94.6 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 63% identical to YAJC_ECO57: Sec translocon accessory complex subunit YajC (yajC) from Escherichia coli O157:H7

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 90% identity to sse:Ssed_2891)

MetaCyc: 63% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV51 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Shewana3_1436 protein translocase subunit yajC (RefSeq) (Shewanella sp. ANA-3)
MELIFMLVIFGLIFYFMIFRPQSKRVKEHKNLMSSLTKGDEVLTSGGILGKIAKISDEND
YVLLSLNDTTQITIKKDYIAAVLPKGSIQSL