Protein Info for Shewana3_1435 in Shewanella sp. ANA-3

Name: tgt
Annotation: queuine tRNA-ribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR00430: tRNA-guanine transglycosylase" amino acids 3 to 369 (367 residues), 609 bits, see alignment E=2.9e-187 TIGR00449: tRNA-guanine family transglycosylase" amino acids 3 to 368 (366 residues), 574.8 bits, see alignment E=6.8e-177 PF01702: TGT" amino acids 11 to 365 (355 residues), 562.4 bits, see alignment E=2.1e-173

Best Hits

Swiss-Prot: 100% identical to TGT_SHESR: Queuine tRNA-ribosyltransferase (tgt) from Shewanella sp. (strain MR-7)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to she:Shewmr4_1382)

MetaCyc: 84% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV50 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Shewana3_1435 queuine tRNA-ribosyltransferase (RefSeq) (Shewanella sp. ANA-3)
MKFELDTTDGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFH
LWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKI
FLDPEKSMQIQHALGSDVVMIFDECTPYPATEDEARKSMQMSLRWAKRSRDEFDRLENPN
SLFGIIQGSVYEDLRDESLKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPADKP
RYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFTSEGVIKIRNARHRDDTSPLDP
KCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQMLMEGLRGAIETGTLDAFVKD
FYTSQGREVPELVD