Protein Info for Shewana3_1431 in Shewanella sp. ANA-3

Annotation: redoxin domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details PF00578: AhpC-TSA" amino acids 55 to 165 (111 residues), 58.9 bits, see alignment E=1.3e-19 PF08534: Redoxin" amino acids 60 to 170 (111 residues), 50.4 bits, see alignment E=5.6e-17 PF13728: TraF" amino acids 70 to 172 (103 residues), 23.4 bits, see alignment E=1.2e-08 PF00085: Thioredoxin" amino acids 75 to 107 (33 residues), 25.3 bits, see alignment 3.3e-09 PF13905: Thioredoxin_8" amino acids 78 to 162 (85 residues), 38.6 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1431)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsD" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV46 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Shewana3_1431 redoxin domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTTANSSAKPAQALNWRQKLQSPRFWLKQLRDLSIMALVLYGVSLYLQRDMITGQAPVLS
GIAIDGSQLALNSAQTEPTLVYFWGTWCPVCRVTSPMVESISQDHNVISVAVASGSDREI
QHYMDEHQYHFPVLNDNKGERSTQWGAMAFPAIYIIDTQGEIRYITSGVTSTWGMKFRLW
LAQF