Protein Info for Shewana3_1428 in Shewanella sp. ANA-3

Annotation: oxidoreductase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF10518: TAT_signal" amino acids 3 to 23 (21 residues), 24.8 bits, see alignment (E = 2.3e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 6 to 26 (21 residues), 18.3 bits, see alignment (E = 1.1e-07) PF01408: GFO_IDH_MocA" amino acids 55 to 181 (127 residues), 67.4 bits, see alignment E=3e-22 PF21252: Glyco_hydro_109_C" amino acids 187 to 449 (263 residues), 358.2 bits, see alignment E=3.8e-111

Best Hits

Swiss-Prot: 100% identical to G1091_SHESA: Glycosyl hydrolase family 109 protein 1 (Shewana3_1428) from Shewanella sp. (strain ANA-3)

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_1375)

Predicted SEED Role

"Predicted secreted alpha-N-acetylgalactosaminidase (EC 3.2.1.49)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 3.2.1.49)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.49

Use Curated BLAST to search for 3.2.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV43 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Shewana3_1428 oxidoreductase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MHNIHRRHFLKAAGAVTAGLVTANIALNANASSVAPKPRVGKSVIGLIAPKMELVRVGFI
GVGERGFSHVEQFCHLEGVELKAICDTHQAVIDRAVEHIVKQNRPKPAVYTGNDLSYREL
LNRDDIDIVIISTPWEWHAPMAIDTMESGKHAFVEVPLALTVEECWQLVDTAERTQKNCM
MMENVNYGREELMVLNMVRQGVFGELLHGEAAYIHELRWQMKEIDHKTGSWRTYWHTKRN
GNLYPTHGLGPISQYMNINRGDRFDYLTSMSSPALGRALYAKREFPADHERNQLKYINGD
MSTSLIKTVKGRTIMVQHDTTTPRPYSRHNLIQGTNGVFAGFPNRIAVEHGGFGKSYHEW
DMDMQKWYDKYDHPLWQRIGKEAEINGGHGGMDFVMLWRMVYCLRNGEALDQDVYDGAAW
SVVNILSEQSLNNRSNSVNFPDFTRGAWEHATPLGIVGA