Protein Info for Shewana3_1416 in Shewanella sp. ANA-3

Annotation: TRAP dicarboxylate transporter, DctP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 41 to 290 (250 residues), 270.6 bits, see alignment E=6.4e-85 PF03480: DctP" amino acids 41 to 323 (283 residues), 344.3 bits, see alignment E=2.8e-107

Best Hits

Swiss-Prot: 78% identical to DCTP_SHELP: Solute-binding protein Shew_1446 (Shew_1446) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 99% identity to shm:Shewmr7_1428)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV31 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Shewana3_1416 TRAP dicarboxylate transporter, DctP subunit (RefSeq) (Shewanella sp. ANA-3)
MTLNQQMGITRPLKTVAKMLALASVFATSFNVFAAPVEIKFSHVVAENTPKGQMALKFKE
LVEQRLPGEYTVSVFPNSQLFGDNNELAALLLNDVQFVAPSLSKFERYTKRLQVFDLPFL
FNDMDAVNRFQQGEAGQALLNSMSRKGIVGLGYLHNGMKQFSANTPLKQPSDAKGLKFRV
MASDVLAAQFDAVGAIPVKKPFSEVFTLLQTRAIDGQENTWSNTYSQKFYEVQSQITESN
HGVLDYMVVTSDAFWKSLPADKRKVIKEALDESIALGNKIAAEKDNEDKQLILDSKRSQL
VTLTPDERQKWIDVMKPVWAKFEDQVGKDVIEAAVAANKQ