Protein Info for Shewana3_1383 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 225 to 252 (28 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details TIGR04370: oligosaccharide repeat unit polymerase" amino acids 23 to 403 (381 residues), 114.8 bits, see alignment E=2.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1383)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUZ8 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Shewana3_1383 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLYFLIVSVIILRITFLKYFNGSRNIGYILPLFLELIFIYPFFIVDILGLKWSIYGFIVL
YSSILSLQIGLLPLKSLPNNRVNAVVIKKKILLNTIYISIPFYLVGVLSNFSLSQLADFS
LSNYLSIANSSALERYSGTQVLTIQYKIGSIFCYYAMFTVGFLVGTKSVKCNSIKHYYFL
AVLLFLIALLDSFLMAARAGMMMMSFCFFSSYFVTSQYLKSGKLIAISIPIIFKLLSVFF
LIFGFFLVIQIFRGGKEDYDFLNIVNHLLTWFIGHISAFSNWIDAYDLYTKPNLGFSTLA
GISDLIGVKERDSGIYVATDIGEGRLTNIYTSLRPLIEDYSILGVFVVYTIFGLIFSFFI
KTKHMQFKGVLFICCVGITVYLCWSFVTSIFVYNTILFSFFCFSLASLFFVKFK