Protein Info for Shewana3_1373 in Shewanella sp. ANA-3

Annotation: amino acid/peptide transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 394 to 418 (25 residues), see Phobius details amino acids 431 to 452 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 9 to 225 (217 residues), 195.4 bits, see alignment E=9.6e-62 amino acids 238 to 457 (220 residues), 160.5 bits, see alignment E=3.8e-51 PF07690: MFS_1" amino acids 49 to 346 (298 residues), 69.5 bits, see alignment E=2.5e-23 PF00854: PTR2" amino acids 91 to 205 (115 residues), 100.3 bits, see alignment E=1.2e-32 amino acids 245 to 418 (174 residues), 120.3 bits, see alignment E=9.6e-39

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 100% identity to shn:Shewana3_1373)

Predicted SEED Role

"Di/tripeptide permease YjdL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUY8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Shewana3_1373 amino acid/peptide transporter (RefSeq) (Shewanella sp. ANA-3)
MSVAKPQGTMLGHPKGLFLLFTTELWERFSYYAMRAILVLYLVDKVQSEGGHGLGWTQAD
AISLYGTFTGLVYLTPLIGGWLADTFLGQRRAIMIGGTLMAAGQFILGTPHAWVPGMETE
VFYVGLGTLILGNGLFKPNISTMVGDLYEEGDHRRDGAFTIFYMGINVGAFLSGIIVGSV
VAAYDGNFQAGFICAGIGMILSLIIQLVFAQKLLGDIGRTPAAKLEKQKAAEKGEVRKEP
LTKVERDRIKVIMVMGLFTIIFWAGFEQAGGLMNLFTNDFTDRMIGTWEVPTTWFQSLNA
MFIVIFAPVVASIWVRLGKNEPNSPVKFALGLVLLAVGFLFMIGAVVEMGGDASAKSSMW
WLVGAYFFHTMGELCLSPIGLSMVTKLAPLRIASLMMGSWFLFVAAANKIGGVVGSFIGH
GGEKEEQLANAMAIFSGIAITAALSGVVLYFMADKLVDWMHGAESKHHNEAEALEDEIAV
TGEHEAIKR