Protein Info for Shewana3_1358 in Shewanella sp. ANA-3

Annotation: cobyrinic acid a,c-diamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF06564: CBP_BcsQ" amino acids 21 to 164 (144 residues), 30.9 bits, see alignment E=7e-11 PF13614: AAA_31" amino acids 21 to 177 (157 residues), 68.3 bits, see alignment E=3e-22 PF10609: ParA" amino acids 21 to 261 (241 residues), 81.2 bits, see alignment E=2.9e-26 PF09140: MipZ" amino acids 22 to 198 (177 residues), 28 bits, see alignment E=4.6e-10 PF01656: CbiA" amino acids 23 to 239 (217 residues), 62 bits, see alignment E=1.9e-20 PF02374: ArsA_ATPase" amino acids 25 to 58 (34 residues), 34.4 bits, see alignment 5e-12 PF00142: Fer4_NifH" amino acids 27 to 264 (238 residues), 52.3 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 99% identity to shw:Sputw3181_1443)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUX3 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Shewana3_1358 cobyrinic acid a,c-diamide synthase (RefSeq) (Shewanella sp. ANA-3)
MTLDQASGLRMMNQPYNEKVKVIAVTGGKGGVGKTSVSINTAVALAEKGKRVLVLDADLG
LANVDVMLGIRAERNLSHVLSGDAELDDIIVRGPKGIGIVPATSGTQGMVELSPAQHAGL
IRAFSEMRTQFDILIVDTAAGISDMVLSFSRASQDVLVVVCDEPTSITDAYALIKILSRE
HGVFRFKIVANMVRSLREGMELFAKLSKVTDRFLDVALELVATIPFDENLRKSVRKQKLV
VEAYPKSPAAIAYHGLANKIMSWPVPQQPGGHLEFFVERLVQRPDFQEEKTSE