Protein Info for Shewana3_1343 in Shewanella sp. ANA-3

Name: fliG
Annotation: flagellar motor switch protein G (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00207: flagellar motor switch protein FliG" amino acids 16 to 346 (331 residues), 317 bits, see alignment E=8.6e-99 PF14842: FliG_N" amino acids 20 to 120 (101 residues), 97 bits, see alignment E=1.9e-31 PF14841: FliG_M" amino acids 131 to 203 (73 residues), 97.5 bits, see alignment E=8.8e-32 PF01706: FliG_C" amino acids 232 to 339 (108 residues), 142 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 70% identical to FLIG_VIBCH: Flagellar motor switch protein FliG (fliG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 99% identity to shm:Shewmr7_1350)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUV8 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Shewana3_1343 flagellar motor switch protein G (RefSeq) (Shewanella sp. ANA-3)
MAENKSKDAAETSSFNIKDLSGIEKTAILLLSLSEADAASILKHLEPKQVQKVGMAMAAM
EDFGQEKVIGVHKLFLDDIQKYSSIGFNSEEFVRKALTAALGEDKAGNLIEQIIMGSGAK
GLDSLKWMDARQVATIIQNEHPQIQTIVLSYLEPDQAAEIFGQFPENTRLDLMMRIANLE
EVQPAALQELNDIMEKQFAGQGGAQAAKMGGLKAAANIMNYLDTGVESQLMETMRETDEE
MAQQIQDLMFVFENLIDVDDRGIQTLLREVQQDVLMKALKGADDQLKDKILGNMSKRAAE
LLRDDLEAMGPIRISEVEIAQKEILSIARRLSDSGEIMLGGGGGDEFL