Protein Info for Shewana3_1290 in Shewanella sp. ANA-3

Annotation: conjugal transfer protein TrbG/VirB9/CagX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03524: CagX" amino acids 103 to 323 (221 residues), 221.5 bits, see alignment E=4.7e-70 TIGR02775: P-type conjugative transfer protein TrbG" amino acids 104 to 311 (208 residues), 296.7 bits, see alignment E=3.9e-93

Best Hits

KEGG orthology group: K03204, type IV secretion system protein VirB9 (inferred from 100% identity to shn:Shewana3_1290)

Predicted SEED Role

"Conjugative transfer protein TrbG" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUQ5 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Shewana3_1290 conjugal transfer protein TrbG/VirB9/CagX (RefSeq) (Shewanella sp. ANA-3)
MNLPFRFHALPLILLALAGCASQGKPPPTISLDESVLAQPLPEPLAPVEVVAVPEPLALP
AQLKPLPEVDAAPAAPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYA
SPGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGSSDALRVNVLVKPIRSGLKTNLVIT
TSRRTYLLELTSTEKAWMASVSWDYPRDRMLALQRQSQAASAAAPVDTGLALEKIRFRYA
VSGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGVQGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDGGDVVRIERTDGVARRN