Protein Info for Shewana3_1288 in Shewanella sp. ANA-3

Annotation: conjugal transfer protein TrbL (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 176 to 192 (17 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 276 to 303 (28 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 1 to 306 (306 residues), 186.7 bits, see alignment E=3.2e-59 PF04610: TrbL" amino acids 37 to 256 (220 residues), 180.1 bits, see alignment E=2.6e-57

Best Hits

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 100% identity to shn:Shewana3_1288)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUQ3 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Shewana3_1288 conjugal transfer protein TrbL (RefSeq) (Shewanella sp. ANA-3)
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDV
IAKLLRKVLYVGAFAYIIGNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGI
DAGAPILEQIGDMAGFPEVFVNIDPIVVMFLAWLVVILCFFVLAVQLFITLIEFKLTTLA
GFVLVPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFAEFQAHPDEPSIDHA
LVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAAVGAVGTGVAIGAAATGVGAA
VAAGARMAPAAAKLAGAGARAATSAAGNARSAFQAGSTAAGGGAKGAAAGLGNVAKTSAQ
AASRRVASGASAAGQKMTSSFRAGWNGSSDDAGAAAAGQSAASEAADGAANSQKQEQPAW
AKRMHRRQQITHAATTTAHTLRGGDGGGSGQGPSLRDSDT