Protein Info for Shewana3_1252 in Shewanella sp. ANA-3
Annotation: DNA repair protein RadC (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to Y1786_VIBCH: UPF0758 protein VC_1786 (VC_1786) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to shn:Shewana3_1252)Predicted SEED Role
"DNA repair protein RadC" in subsystem DNA repair, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KUL8 at UniProt or InterPro
Protein Sequence (169 amino acids)
>Shewana3_1252 DNA repair protein RadC (RefSeq) (Shewanella sp. ANA-3) MTQLSFSSFDSSLLVRDAQGRYLPASVDQILDAARQVIDQKIQRGMSFTSPTLVKEYLCA KLAGFEHEVFAVLFLDSQHRLIEYTEMFRGTIDSASVYPREVVKEALRLNAAAVIFSHNH PSGNSEPSRADEAITNRLKEALALVDVRSLDHVIVAGSDTMSFAERGLI