Protein Info for Shewana3_1243 in Shewanella sp. ANA-3

Annotation: cyd operon protein YbgT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 38 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08173: YbgT_YccB" amino acids 1 to 26 (26 residues), 62.7 bits, see alignment E=1.3e-21 TIGR02106: cyd operon protein YbgT" amino acids 1 to 30 (30 residues), 67.9 bits, see alignment E=3.5e-23

Best Hits

Swiss-Prot: 64% identical to CYDX_ECOLI: Cytochrome bd-I ubiquinol oxidase subunit X (cydX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to saz:Sama_2347)

MetaCyc: 64% identical to cytochrome bd-I accessory subunit CydX (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUK9 at UniProt or InterPro

Protein Sequence (38 amino acids)

>Shewana3_1243 cyd operon protein YbgT (RefSeq) (Shewanella sp. ANA-3)
MWYFTWILGVLLACSFGVINALWLENTENMDRSSDDAE