Protein Info for Shewana3_1235 in Shewanella sp. ANA-3

Annotation: inosine 5'-monophosphate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 8 to 454 (447 residues), 646.1 bits, E=1.6e-198
• PF00478: IMPDH
  • amino acids 8 to 473 (466 residues), 542.1 bits, E=1e-166
• PF00571: CBS
  • amino acids 96 to 140 (45 residues), 36.4 bits, 1.1e-12
  • amino acids 149 to 204 (56 residues), 37.3 bits, 5.8e-13

Best Hits

Swiss-Prot: 78% identical to IMDH_PASMU: Inosine-5'-monophosphate dehydrogenase (guaB) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 99% identity to spc:Sputcn32_2646)

MetaCyc: 80% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (3/7 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See A0KUK1 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Shewana3_1235 inosine 5'-monophosphate dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MLRLIKEALTFDDVLLVPAHSTVLPNTAILKTRLTNTIELNIPLVSAAMDTVTEARLAIA
MAQEGGLGFIHKNMSIEKQAEEVRKVKIYEAGVVQQPVTVTPSTTLADLKVLTAKNGFAG
YPVVNEANELVGIITGRDVRFVTDWSKTVEEVMTPKARLVTVAEGTKLDEVQKLMHSNRI
EKVLVVDDNFKLKGLITVKDFEKAERKPNACKDELGRLRVGAAVGAGAGNEERVDALVKA
GVDVLLIDSSHGHSEGVLQRIRETRAKYPELQIIGGNVATAEGALALVEAGVNAVKVGIG
PGSICTTRIVTGVGVPQITAVSDAAEAVKGLGIPVIADGGVRFSGDLAKALAAGASCIMA
GSMFAGTDEAPGETELYQGRAYKSYRGMGSLGAMSQGSSDRYFQSDNAADKLVPEGIEGR
VPYKGKLKEIIHQHMGGLRSCMGLTGCATIQELNEKAQFVKVTSAGMGESHVHDVTITKE
APNYRSGA