Protein Info for Shewana3_1152 in Shewanella sp. ANA-3

Annotation: two component LuxR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 22 to 132 (111 residues), 101 bits, see alignment E=4.5e-33 PF00196: GerE" amino acids 164 to 217 (54 residues), 63.5 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 35% identical to VRAR_STAS1: Response regulator protein VraR (vraR) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1152)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUB8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Shewana3_1152 two component LuxR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MESQHKVTTYGQPTARTIRVGLVEDQQLVRQGIASLIAISQHIEVSWQAENGQEALKRLQ
TDAVDVLLSDIRMPVLDGISLLKQLRAAQNSIPVIMLTTFDDSELFLNSLQAGANGFLLK
DVSLDKLLEAIETVAQGGHLIEPSVLEQMQQSSATAQSGPTHDLLSEREREILGFMAGGF
SNKEIANAVFLAEGTVKNHVSTILAKLDCRDRTQAVLKGLQLSLI