Protein Info for Shewana3_1150 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 146 to 165 (20 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details PF13426: PAS_9" amino acids 15 to 105 (91 residues), 36.3 bits, see alignment E=1.2e-12 TIGR00229: PAS domain S-box protein" amino acids 18 to 117 (100 residues), 42.1 bits, see alignment E=4.3e-15 PF00989: PAS" amino acids 21 to 106 (86 residues), 33.5 bits, see alignment E=7.5e-12 PF08447: PAS_3" amino acids 29 to 112 (84 residues), 56.5 bits, see alignment E=5.4e-19 PF00015: MCPsignal" amino acids 304 to 480 (177 residues), 130.3 bits, see alignment E=1.4e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1150)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUB6 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Shewana3_1150 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella sp. ANA-3)
MQTHSKNGEKHLSENAILLSTTDLKGNIKYVNQTFSQISEYSVAELQGSPHNIVRHGDMP
SAAFKMLWERIRSGKPWMGIVKNRTKNGGYYWVNAYVAPVYENGKIHEYQSVRRQATPEQ
IKAAEEIYQGINQGQQPKALKKDRLGFRGKILMAMLFTIALTAYLATYSPILAALAGGLL
ALGLWYMLMQPFQALVQVASNIIDDPVAMGVYTGRQDEIGKLDLALRFLITEIGGVVGRM
ADSASEIQEQSVNLKQTITNTWEHADSQSAQTTQAATAMEQMSASFAEVTDNIHRTASEM
VSSHEAAQRGHSRLETVIEAIHQLSVQVSHFSDVVQTIEQDSQAIHQVLEVIRAIADQTN
LLALNAAIEAARAGESGRGFAVVADEVRQLSSRTSQSTSQIELIVSRFKDSTQKATSTMT
AGQEQVKRSVSLAQDASIAFGELLSSIARINSLSDDNAAAMTQQASVAAEISRAIHVISD
LAQQSLEQTQDAAARGDQVSRLSTKTHHLSQQFWQQSVQRKY