Protein Info for Shewana3_1148 in Shewanella sp. ANA-3

Annotation: PepSY-associated TM helix domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 349 to 374 (26 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details amino acids 492 to 515 (24 residues), see Phobius details PF03929: PepSY_TM" amino acids 11 to 375 (365 residues), 217.5 bits, see alignment E=1.9e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1148)

Predicted SEED Role

"FIG138928: iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUB4 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Shewana3_1148 PepSY-associated TM helix domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MKETFFRTLSWLHTWAGLLVCWVLLLIFFAGSLSYFRHEMSLWAEPELHRGAFQDYQTNQ
VASQLDQGQDYIEAHSAATTQRWLINFPTDRSPMLSFAWQLPPEKGQRRGKIEQHVTKAD
GSGMITDVRDSRGGDFFYRLHFDLHYMPAITARYIVGVCTMFMLIALISGIVIHKRIFKD
LFSFRQNKGARSWLDAHNVSSVIALPYHLMITYTGLITLMLIYIPWTVSTAYPEDNQAFL
KELNPARQTEKASGIQAKQVRLSQLLPQVQAEWGDAPIKQVIVSYPKDQNSQVTFYQNTG
KDVTDESTLLVFNGVTGELKYASPHEMSATVVTYDTMMSLHTARFAAPLLRILFFFCGLL
GCAMVATGTLMWAIRLRQKQQKAIDKGEKASRGLRLVEGLNFMFILGLPLGAAAFFYANR
LLPTDFAARSAWEVHSFFIALGVMGVWAFFGRSRRHWQFALMLIGALYCALPLLNAATSP
SHLIDNIRSQQWALVGFDVLALLLGCAMLFASTRLSAVVKTLQKPSRKNTTAVEKVRRKQ
PDPSYANELASSSPLEEAKS