Protein Info for Shewana3_1127 in Shewanella sp. ANA-3

Annotation: regulatory protein RecX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF02631: RecX_HTH2" amino acids 12 to 52 (41 residues), 50.3 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 88% identical to RECX_SHEON: Regulatory protein RecX (recX) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03565, regulatory protein (inferred from 100% identity to shn:Shewana3_1127)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU93 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Shewana3_1127 regulatory protein RecX (RefSeq) (Shewanella sp. ANA-3)
MLDDCEASGFINDKRYAELLVRSHIARGHGPIRIRQAIAQKGLLKDCIEAALSANDHDWF
ELAKAKAIKKYAIPKVTEVKGSQSRELVAKEKAKRVRFLLSQGFNYEQVSYALDYDPMED
NDD