Protein Info for Shewana3_1126 in Shewanella sp. ANA-3

Name: recA
Annotation: recombinase A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR02012: protein RecA" amino acids 6 to 326 (321 residues), 563.2 bits, see alignment E=9.3e-174 PF00154: RecA" amino acids 9 to 270 (262 residues), 473.5 bits, see alignment E=3.6e-146 PF08423: Rad51" amino acids 38 to 229 (192 residues), 36.5 bits, see alignment E=6.8e-13 PF06745: ATPase" amino acids 42 to 198 (157 residues), 31 bits, see alignment E=3.3e-11 PF21096: RecA_C" amino acids 273 to 328 (56 residues), 82.2 bits, see alignment E=4.6e-27

Best Hits

Swiss-Prot: 100% identical to RECA_SHESA: Protein RecA (recA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03553, recombination protein RecA (inferred from 99% identity to shm:Shewmr7_1196)

MetaCyc: 86% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU92 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Shewana3_1126 recombinase A (RefSeq) (Shewanella sp. ANA-3)
MKVDPNKEKALAAVLSQIEKQFGKGSIMKLGEDRSMDVETISTGSLSLDVALGAGGLPMG
RIVEIYGPESSGKTTLTLEVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQP
DTGEQALEICDALTRSGAVDVIIVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGDEVVG
NETRVKVVKNKVAAPFKQAEFQILYGQGINRTGELVDLGVAHKLIEKAGAWYSYKGDKIG
QGRANAGKYLTENPAIAAEIDKTLRELLLSNPSAMSSSSSDDENSEGNVDFETGEVF