Protein Info for Shewana3_1118 in Shewanella sp. ANA-3

Name: ispD
Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 26 to 244 (219 residues), 247 bits, E=2e-77
• PF12804: NTP_transf_3
  • amino acids 28 to 178 (151 residues), 49.7 bits, E=4.8e-17
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 28 to 244 (217 residues), 235.9 bits, E=1.7e-74

Best Hits

Swiss-Prot: 89% identical to ISPD_SHEON: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 100% identity to shn:Shewana3_1118)

MetaCyc: 56% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

See A0KU84 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Shewana3_1118 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (RefSeq) (Shewanella sp. ANA-3)
MDTVLEAAPQVETQVAVQIDPFSHHVVAIVPAAGIGSRMGAGKPKQYLTLLGQSILAHTL
DKLLSHPQINQVIVALHPEDTKFAALPQAKHPKLVTVIGGSERADSVLAALDKAPDNGWA
LVHDAARPCLTAQDIDKLLASRVHFPQGAILAMPVRDTMKRANSLGEISSTVCRDNLWHA
LTPQLFPTSLLRLHLKAALAAGAVVTDEASAMEWAGISPGLVAGRADNIKVTHPDDLELA
ELFLLRANA