Protein Info for Shewana3_1097 in Shewanella sp. ANA-3

Annotation: riboflavin synthase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00187: riboflavin synthase, alpha subunit" amino acids 1 to 195 (195 residues), 212 bits, see alignment E=2.5e-67 PF00677: Lum_binding" amino acids 3 to 87 (85 residues), 71.1 bits, see alignment E=3.1e-24 amino acids 100 to 184 (85 residues), 90.1 bits, see alignment E=3.8e-30

Best Hits

Swiss-Prot: 56% identical to RISA_PHOPO: Riboflavin synthase (ribE) from Photobacterium phosphoreum

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 99% identity to son:SO_3468)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.9

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU63 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Shewana3_1097 riboflavin synthase subunit alpha (RefSeq) (Shewanella sp. ANA-3)
MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVVQQLADGYV
ADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLARGQAIE
FWLAAPTELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKAGDKVN
IEVDLIARYLERLMRFDTKETQGGGVTMEMLARAGFVR