Protein Info for Shewana3_1079 in Shewanella sp. ANA-3

Annotation: metal dependent phosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF01966: HD" amino acids 36 to 147 (112 residues), 30.6 bits, see alignment E=5.4e-11 amino acids 247 to 368 (122 residues), 67.4 bits, see alignment E=2e-22 PF13487: HD_5" amino acids 236 to 401 (166 residues), 118.3 bits, see alignment E=4.7e-38 TIGR00277: HDIG domain" amino acids 247 to 337 (91 residues), 34 bits, see alignment E=1.1e-12 PF08668: HDOD" amino acids 249 to 293 (45 residues), 27.3 bits, see alignment 3.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1079)

Predicted SEED Role

"Putative metal-dependent phosphohydrolase with tandem HD motifs"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU45 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Shewana3_1079 metal dependent phosphohydrolase (RefSeq) (Shewanella sp. ANA-3)
MNAFQPQEISIKIDVRHALLAVATALDFVGVDDLHHGHRVAYMAYECANVLGWSDEKKQF
AYFAGLIHDCGVSSSEEHLRLLKLMQPEDATSHSRRGYEALMKCPILDAFALTVLYHHTP
WLELQTAAISEFDRDLAALVFLADRTDFLRARYTHGCHQELITLHEGLVADNLLAHSGVL
FEPNMVAAMCQLVSKDGFWYNMEAAHIEQMALEFEANQLYDKQLDLEGVKQISRFLARIV
DAKSPFTFHHSDKVALLAKLVAKDCGISDTDAELLYVAGLLHDVGKLKTPDLLLHKEGKL
TREEYSIMKRHTVDTDHTLKSFFPKSVIGEWASNHHERLDGSGYPFRKGPEQLDLPSRIL
ALVDVFQALTQKRPYRGSMSLSEVLEIMLPMVQQGKLDSNVYDVLLADADNFYQLSTQEY
EA