Protein Info for Shewana3_1024 in Shewanella sp. ANA-3

Annotation: dihydropteroate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to DHPS_ECOLI: Dihydropteroate synthase (folP) from Escherichia coli (strain K12)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 100% identity to shn:Shewana3_1024)

MetaCyc: 62% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

superpathway of chorismate metabolism (51/59 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
tetrahydrofolate biosynthesis I (3/3 steps found)
superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
tetrahydrofolate biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTZ0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Shewana3_1024 dihydropteroate synthase (RefSeq) (Shewanella sp. ANA-3)
MFELIAGTKRLSLASPVVMGILNVTPDSFSDGGKFSSFELACQHADEMVAQGALIIDIGG
ESTRPGAADVSVQDELARVIPLVEYVAKHHDVWISVDTSKPEVMRQAVNAGAHLINDVRA
LLEPGALETAAQLNVPICLMHMQGAPRSMQTAPEYQDLVADVSEFLYERIQACIDAGIPR
ERLLIDPGFGFGKTLEHNYELLAKLDSFEQFELPILIGLSRKSMIGNLLARPTSERLAGS
LAGAMIAAQKGAHIIRVHDVPETVDMLKVLQATQAYL