Protein Info for Shewana3_1019 in Shewanella sp. ANA-3

Name: secD
Annotation: preprotein translocase subunit SecD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 487 to 509 (23 residues), see Phobius details amino acids 515 to 534 (20 residues), see Phobius details amino acids 555 to 579 (25 residues), see Phobius details amino acids 586 to 613 (28 residues), see Phobius details PF13721: SecD-TM1" amino acids 10 to 111 (102 residues), 57.7 bits, see alignment E=3.5e-19 TIGR01129: protein-export membrane protein SecD" amino acids 139 to 610 (472 residues), 411.9 bits, see alignment E=3.2e-127 PF21760: SecD_1st" amino acids 252 to 310 (59 residues), 84.8 bits, see alignment 5.5e-28 PF22599: SecDF_P1_head" amino acids 319 to 440 (122 residues), 103.3 bits, see alignment E=1.8e-33 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 360 to 603 (244 residues), 239.4 bits, see alignment E=3.8e-75 PF02355: SecD_SecF_C" amino acids 442 to 612 (171 residues), 63.7 bits, see alignment E=4e-21 PF03176: MMPL" amino acids 497 to 600 (104 residues), 23.1 bits, see alignment E=8.4e-09

Best Hits

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 100% identity to shn:Shewana3_1019)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTY5 at UniProt or InterPro

Protein Sequence (624 amino acids)

>Shewana3_1019 preprotein translocase subunit SecD (RefSeq) (Shewanella sp. ANA-3)
MDKIQSKKLLNHYSAWKYLVLIVTIIVMLFSALPTWYGEDAAVQVGAKAGLNLTPIELRD
KLKAQGVEVKRIEVKHAQQGSANSSEGGQTLIVLNDDSEQTLVKTLVSSMVSEPKELTLA
LVSAAPSWLQNMGFEPIKLGLDLRGGVQFLLDVDVQPVYQAQADALVESLRLFLREQQIR
GASVRIDSTRDDAGLQIEIAFNDAAQSTNNARSTIRQFMQQSYPTWQLTNADNGLVVKLA
QEEQIKLRNLTVQQNLQIMRSRIEELGITEALVQRQGEHRIRIELPGVQDPAAAKNVIGA
TASLAFFEVKESGSVNAQVLKDKSGNPVYVARTPVLGGDHIVDARANIGEMGMAEVNIHL
DRIGGQKMSEFSRANIGKPMATSYSEYSRDEQGKAKQTQEIISVATIQSQLGDRFRITGA
GTYQEAQQLALLLRAGSMTAPVTIVEERTIGPTLGAENIQNGFAALGLGMGITLLFMALW
YRRLGWVANVALIANMVILFGLLALIPGAVLTLPGIAGLVLTVGMAVDTNVLIFERIKDK
LKEGRSFALAIDTGFDSAFSTIFDANFTTMITAVVLYSIGNGPIQGFALTLGLGLLTSMF
TGIFASRALINLVYGRDARRHVRV