Protein Info for Shewana3_0994 in Shewanella sp. ANA-3

Annotation: rod shape-determining protein RodA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 138 to 154 (17 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 263 to 288 (26 residues), see Phobius details amino acids 304 to 331 (28 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details TIGR02210: rod shape-determining protein RodA" amino acids 16 to 363 (348 residues), 454.7 bits, see alignment E=1.1e-140 PF01098: FTSW_RODA_SPOVE" amino acids 21 to 363 (343 residues), 391.3 bits, see alignment E=2.1e-121

Best Hits

Swiss-Prot: 61% identical to RODA_ECO57: Peptidoglycan glycosyltransferase MrdB (mrdB) from Escherichia coli O157:H7

KEGG orthology group: K05837, rod shape determining protein RodA (inferred from 100% identity to shn:Shewana3_0994)

MetaCyc: 61% identical to peptidoglycan glycosyltransferase MrdB (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Rod shape-determining protein RodA" in subsystem Bacterial Cytoskeleton or Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTW0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Shewana3_0994 rod shape-determining protein RodA (RefSeq) (Shewanella sp. ANA-3)
MSAQPRQNIWQRMHIDLPLLLGLFAVMGFGLFVIYSASGEDLGMMERQLFRMFLSLGIMF
TMAQINPEALKRWALPIYLAGIVLLLGVHFFGEINKGAQRWLNLGFMEFQPSELIKLAFP
ITMAWYISKFPLPPKKRYLAGAAVILLVPTLLIAKQPDLGTSILVAASGIFVLFLSGMSW
AIVGGFIAAVLAFLPILWYFLMHDYQRTRVMTLLDPEKDPLGAGYHIIQSKIAIGSGGLW
GKGWLDGTQSQLEFIPERHTDFIFAVIGEEFGLIGSIILLLMYLYIIGRGLVIASRAQTS
FARLLAGSITLTFFVYVFVNIGMVSGILPVVGVPLPLVSYGGTSMLTLMTGFGILMSIHT
HRRFVDR