Protein Info for Shewana3_0966 in Shewanella sp. ANA-3

Annotation: dihydrodipicolinate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01113: DapB_N" amino acids 5 to 128 (124 residues), 144.5 bits, see alignment E=1.8e-46 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 5 to 268 (264 residues), 354.1 bits, see alignment E=2.8e-110 PF05173: DapB_C" amino acids 131 to 267 (137 residues), 153.4 bits, see alignment E=3e-49

Best Hits

Swiss-Prot: 100% identical to DAPB_SHESA: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to shn:Shewana3_0966)

MetaCyc: 67% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTT2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Shewana3_0966 dihydrodipicolinate reductase (RefSeq) (Shewanella sp. ANA-3)
MGGQVRVAIVGAGGRMGRTLIESAYHQEHIRLGAAIERPGSSLVGVDAGELVGVGKLNVI
IMDSLDYATDDFDVLIDFTAPEASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQT
PVVMAPNMSVGVNLMWKLLELAAEVMGDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAKT
LGRDLEKCAVYGREGITGERDRETIGFATVRAGDLVGEHTAMFADIGERLEITHKASSRM
TFANGAMRAAHWLVEQKPGLYDMQQVLGLN