Protein Info for Shewana3_0885 in Shewanella sp. ANA-3

Annotation: LrgA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 14 to 14 (1 residues), see Phobius details transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details PF03788: LrgA" amino acids 29 to 121 (93 residues), 85.8 bits, see alignment E=8.2e-29

Best Hits

KEGG orthology group: K06518, holin-like protein (inferred from 99% identity to shm:Shewmr7_0922)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTK4 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Shewana3_0885 LrgA family protein (RefSeq) (Shewanella sp. ANA-3)
MSFLQAAIRRCRHGALLLTQIGLFCLLSFACHWLATWAHLPVPGSVLGLGILLILLATKL
IPENAVQLGAAWLIGELLLFFIPPVISVIKYEGLFEQYGVNILFTLVMGSVCVMVGTGFV
VDRVFRFERQLNIKKHARRHAKAA