Protein Info for Shewana3_0881 in Shewanella sp. ANA-3

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 161 to 175 (15 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 117 (95 residues), 79.5 bits, see alignment E=1.1e-26 PF00528: BPD_transp_1" amino acids 42 to 223 (182 residues), 89 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 43% identical to GLNP_RICTY: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia typhi (strain ATCC VR-144 / Wilmington)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to son:SO_1043)

MetaCyc: 36% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTK0 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Shewana3_0881 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Shewanella sp. ANA-3)
MLEAINTSLFSPIGDDGMIGILLILNGLKVTLIVTFFAMLLGAVLGVGTTLMKMSSKWYI
RFPAELYVGVIRGTPVVVQLVILYFIVLAAFDVDKVTAAIIAFGLNSGAYISEIIRAGIQ
AVDKGQTEAARSLGLSQAMTMKLIILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLM
RAGEIIRSRTFEDSIPLFTCALIYLFLTYSFTFMLSKFEKRLKQSD