Protein Info for Shewana3_0866 in Shewanella sp. ANA-3

Annotation: adenylylsulfate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR00455: adenylyl-sulfate kinase" amino acids 6 to 190 (185 residues), 257.1 bits, see alignment E=4.1e-81 PF01583: APS_kinase" amino acids 24 to 173 (150 residues), 223.6 bits, see alignment E=1.2e-70

Best Hits

Swiss-Prot: 100% identical to CYSC_SHESA: Adenylyl-sulfate kinase (cysC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to shn:Shewana3_0866)

MetaCyc: 68% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTI5 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Shewana3_0866 adenylylsulfate kinase (RefSeq) (Shewanella sp. ANA-3)
MSNIVWHQHSVDQAARAKLKGQNPVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDG
DNVRHGLCKDLGFSVADRDENLRRVGEVAKLMVDAGLVVLSAFISPTREERDSIRARFPE
GQFIEVHVSTPLSICEQRDPKGLYVKARRGEISNFTGISSPYEAPLSAELTIDTSKGDLA
SQVRALIDYLTAIGVINPDKAKALA