Protein Info for Shewana3_0858 in Shewanella sp. ANA-3

Annotation: monofunctional biosynthetic peptidoglycan transglycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 35 to 60 (26 residues), see Phobius details TIGR02070: monofunctional biosynthetic peptidoglycan transglycosylase" amino acids 34 to 250 (217 residues), 281.9 bits, see alignment E=1.7e-88 PF00912: Transgly" amino acids 81 to 246 (166 residues), 171.3 bits, see alignment E=7.2e-55

Best Hits

Swiss-Prot: 91% identical to MTGA_SHEON: Biosynthetic peptidoglycan transglycosylase (mtgA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03814, monofunctional biosynthetic peptidoglycan transglycosylase [EC: 2.4.1.-] (inferred from 100% identity to shn:Shewana3_0858)

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTH7 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Shewana3_0858 monofunctional biosynthetic peptidoglycan transglycosylase (RefSeq) (Shewanella sp. ANA-3)
MTAPMYAMRDHVNRPQGNKSNRPAQKPKARGLKRIVAWLVKLILGLLLASILSVVLLRFI
DPPMWTWRIERALFPPAPVTEVRHQWRSLEQISPELQLAVIAAEDQKFASHTGFDLAAIS
SAIEYNQKGNKVRGASTLSQQAAKNLFMWSSRSFIRKGIEAWFTLLMELIWDKSRILEVY
LNIVEFGPGIYGAEAASKHYFGKSAAKLTRYEASLLAAVLPNPWRYKVSPPSPYVEQRSA
WIRKQMRQLGEVTLNRVHQAD