Protein Info for Shewana3_0857 in Shewanella sp. ANA-3

Annotation: phosphoadenosine phosphosulfate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR02057: phosphoadenosine phosphosulfate reductase" amino acids 41 to 262 (222 residues), 283.9 bits, see alignment E=1.1e-88 TIGR00434: phosophoadenylyl-sulfate reductase" amino acids 53 to 262 (210 residues), 275.1 bits, see alignment E=4.6e-86 PF01507: PAPS_reduct" amino acids 68 to 240 (173 residues), 187.5 bits, see alignment E=1.1e-59

Best Hits

Swiss-Prot: 96% identical to CYSH_SHEON: Phosphoadenosine phosphosulfate reductase (cysH) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to she:Shewmr4_3078)

MetaCyc: 62% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTH6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Shewana3_0857 phosphoadenosine phosphosulfate reductase (RefSeq) (Shewanella sp. ANA-3)
MADLDSGVTGSGLPNALQSVVSHSELKALLTAPKDVQQAELERINRFLAGLTAQERVLWG
LAYLPGNHALSSSFGIQAAVMLHMVSQVQSDIPVILTDTGYLFPETYQFIDQLTERLSLN
LKVYQAPMTSAWQEARFGKLWEQGLDGLERYNRLNKVEPMQRALAELEVGTWFAGLRRSQ
SSTREELPILAIHGTRFKLLPIIEWSNKDVHLYLTQFDLPYHPLWDQGYVSVGDTHSSKP
LELGMTEEETRFNGLKRECGLHYEI