Protein Info for Shewana3_0847 in Shewanella sp. ANA-3

Annotation: potassium/proton antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 46 (17 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 185 to 211 (27 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 243 to 259 (17 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 19 to 387 (369 residues), 198.1 bits, see alignment E=3.2e-62 PF02080: TrkA_C" amino acids 422 to 484 (63 residues), 41.1 bits, see alignment E=2.1e-14 PF03471: CorC_HlyC" amino acids 496 to 570 (75 residues), 37.8 bits, see alignment E=2.3e-13

Best Hits

Swiss-Prot: 100% identical to NHAP2_SHESA: K(+)/H(+) antiporter NhaP2 (nhaP2) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to shn:Shewana3_0847)

Predicted SEED Role

"K+/H+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTG6 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Shewana3_0847 potassium/proton antiporter (RefSeq) (Shewanella sp. ANA-3)
MDADSINSFFLIGALLAAVSVLLSPVSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
AELSVSFMLISFIKQFGLGIFLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLMIYAASN
KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
LPGLALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
HLSENKWCIGEPLKRLSMPDGTRIAAVFRHNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
SNLFSQAPETKEVPRFFGDFFIDTEVKLLDLAPIYGLELDEATGDMTVADLVAAELGSHP
VLGDQFLWQSLHWVVAGLNEGKVTNVGIRLPAEA