Protein Info for Shewana3_0845 in Shewanella sp. ANA-3

Annotation: anaerobic nitric oxide reductase transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF01590: GAF" amino acids 24 to 155 (132 residues), 44.9 bits, see alignment E=5.3e-15 PF00158: Sigma54_activat" amino acids 192 to 358 (167 residues), 236.8 bits, see alignment E=3.3e-74 PF14532: Sigma54_activ_2" amino acids 193 to 363 (171 residues), 88.7 bits, see alignment E=1.3e-28 PF07728: AAA_5" amino acids 215 to 334 (120 residues), 32.1 bits, see alignment E=3.3e-11 PF00004: AAA" amino acids 216 to 348 (133 residues), 22.1 bits, see alignment E=5.2e-08

Best Hits

Swiss-Prot: 61% identical to NORR_PECAS: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to shn:Shewana3_0845)

Predicted SEED Role

"Anaerobic nitric oxide reductase transcription regulator NorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTG4 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Shewana3_0845 anaerobic nitric oxide reductase transcription regulator (RefSeq) (Shewanella sp. ANA-3)
MALSQTDLTRIALDITSGLAHRDRFSRLLDTVRANLHCDAAALLTFHGHYFTPLAIDGLN
EDVLGRRFILNEHPRLEAIARAGDIVRFPADSELADPYDGLIPNQTGALKVHACIGLPLF
ADEQLIGAVTIDAFNSLQFDQFSNTELRSLSAIAAASLSNALLVEKLERMALNSHSSHVQ
EKSPNLNHDAEIIGNSSQMQSLNREIEVVAHSDLNVLILGETGTGKELVAQSIHQKSARS
HKPLVYLNCAALPESVAESELFGHIKGAFTGAISHRSGKFEMADKGTLFLDEIGELPLTL
QAKLLRVLQYGDIQKVGDDRSLKVDVRIIAATNKDLKTEVLAGRFRADLYHRLSVFPLLV
PPLREREQDITLLSGFFAERYRQKLGMKQLNFSPSSLILLNQYTWPGNVRELEHAIHRAT
VLARVSAQDGCCTIAPQHFDLPFKQSPLETNASTSLSVNDMQLRPLEGASLAQATDAFQR
DFIKQVLTAQNGNWAASARVLGLDPGNLHRLAKRLRLK