Protein Info for Shewana3_0833 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase with GAF sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF13185: GAF_2" amino acids 25 to 152 (128 residues), 39.9 bits, see alignment E=7.1e-14 PF01590: GAF" amino acids 26 to 158 (133 residues), 70 bits, see alignment E=4.4e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 163 to 315 (153 residues), 124.6 bits, see alignment E=1.6e-40 PF00990: GGDEF" amino acids 165 to 315 (151 residues), 129.2 bits, see alignment E=1.9e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0833)

Predicted SEED Role

"Diguanylate cyclase with GAF sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTF2 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shewana3_0833 diguanylate cyclase with GAF sensor (RefSeq) (Shewanella sp. ANA-3)
MQLPPVPENELQRLATLRALNVLDTDAEERFDRITRLTRRIFSLPICLVTLVDANRQWFK
SRQGIEVEQTPRDISLCAHAINHDGIFVVHDALKDPRFCDNPLVTEPPHIRFYVGYPLTI
QGEYRVGTLCLIGNEPRDFTEEDAETLTDLGQMVEAELLSIAQNTLDPLTMISNRRGFEL
LAYQSLASCRRTDAEAALVFFDLDFFKEVNDSFGHRKGDQLLYDFAHILMAAFRESDVIA
RLGGDEFVVLLSFIERDTVNFAIERFKLLLGEYNQQHSEHPLETSIGIAHWSPASDMNLD
DLLDAADRAMYRDKAVHHLDKP